PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do029553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 343aa    MW: 37010.2 Da    PI: 6.4335
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do029553.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.77e-10147194552
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                 kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  Do029553.1 147 KRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 194
                 9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-14143207IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599145208IPR004827Basic-leucine zipper domain
PfamPF001709.6E-9147191IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-11147198No hitNo description
Gene3DG3DSA:1.20.5.1708.0E-10147201No hitNo description
CDDcd147038.69E-22148197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MQQQPEPADP PGRAFPPPPA PAARGAHHRR ARSEVAFRLP DDLGLGGGGG PDGDGFDEIG  60
SEDDLFSTFM DMDKITGADR DRAAETSSSP RPKHRHSSSV DGSGLFFSPG SGGGAGKDAA  120
ASLAEVMEAK KAMSPEQLAE LAAIDPKRAK RILANRQSAA RSKERKARYI TELERKVQTL  180
QTEATTLSAQ LTLFQRDTTG LSAENAELKI RLQAMEQQAQ LRDALNDALK QELERLKLAT  240
GETTNSSETY NMRFQHVPYN SSFFPLSQQN IAPHPGSAQL APPFLPPHPN VPNHQMLSHP  300
NTLQDIMQQD SLGRLQGLDI GKGPLVVKSE NSSISASESS STF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0332100.0BT033210.1 Zea mays full-length cDNA clone ZM_BFb0176L19 mRNA, complete cds.
GenBankBT0632630.0BT063263.1 Zea mays full-length cDNA clone ZM_BFc0045A20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984459.11e-177PREDICTED: transcription factor RF2b
SwissprotQ6S4P41e-164RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0A9NWC60.0A0A0A9NWC6_ARUDO; Uncharacterized protein
STRINGSi036380m1e-176(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.12e-69basic leucine-zipper 52